PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00023.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 436aa    MW: 48969.9 Da    PI: 8.3115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00023.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-17171231148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.............TTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg.............kgRtlkqcksrwqkyl 48 
                              +g WT+eEd++lv+ ++++G g+W+tI+++ g             ++R++k+c++rw +yl
  Rsa1.0_00023.1_g00016.1 171 KGQWTPEEDKILVKHIEKHGCGRWNTIPKHAGkthnnffdfilsrLRRCGKSCRLRWKNYL 231
                              799********************************************************97 PP

2Myb_DNA-binding46.39.9e-15237279145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              rg++T e+++l++++ ++lG++ W+tIa +++ gRt++++k+ w+
  Rsa1.0_00023.1_g00016.1 237 RGPFTFEDEKLILQLQARLGNR-WSTIATHLP-GRTDNDIKNLWN 279
                              89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.189166231IPR017930Myb domain
SuperFamilySSF466894.31E-28168278IPR009057Homeodomain-like
SMARTSM007172.6E-13170233IPR001005SANT/Myb domain
PfamPF002492.7E-16171231IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-23172238IPR009057Homeodomain-like
CDDcd001674.76E-12174231No hitNo description
PROSITE profilePS5129422.447232286IPR017930Myb domain
SMARTSM007171.3E-12236284IPR001005SANT/Myb domain
PfamPF002495.7E-13237280IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-22239285IPR009057Homeodomain-like
CDDcd001673.46E-9239279No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MFDRAAVFPK IIRAAVFVTL KRSKIRIYGR LVLPVFKNLV NLSFGSYNEQ SWKLLPYLLK  60
QSPKVETLII QGLEDGGYTG NVTIGQFQVK ELHVVGYKGT AKELLHLKSL LAGTECIPRV  120
RVVFPEDVVV DAATIFQTRR DLFTLVGVVS TEIVRKMGRR AAYRGEQGLK KGQWTPEEDK  180
ILVKHIEKHG CGRWNTIPKH AGKTHNNFFD FILSRLRRCG KSCRLRWKNY LNPDIKRGPF  240
TFEDEKLILQ LQARLGNRWS TIATHLPGRT DNDIKNLWNS RVKKRSLLDL DDPTTEASPT  300
TGVMSQWESA TLEPEPRLPG ETSADCDNFF DIWNSEIVES FTTTLAPWYE STSCQIPFSR  360
TPSSSSSALV KSSTDSCGSK DVDMASCSSS SCTKDDDDFA LQLLLDSPLI GGDDDIDMTF  420
LEEKSDGKTQ SPAVGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2916928525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191684.14e-80LATE MERISTEM IDENTITY2
TrEMBLQ9M2D95e-80Q9M2D9_ARATH; At3g61250
STRINGAT3G61250.11e-79(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2899922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.18e-66myb domain protein 17